Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase CHK2
LigandBDBM50163283
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305572
IC50 6000±n/a nM
Citation Arienti, KLBrunmark, AAxe, FUMcClure, KLee, ABlevitt, JNeff, DKHuang, LCrawford, SPandit, CRKarlsson, LBreitenbucher, JG Checkpoint kinase inhibitors: SAR and radioprotective properties of a series of 2-arylbenzimidazoles. J Med Chem48:1873-85 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase CHK2
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:Cds1
Type:Protein
Mol. Mass.:60908.59
Organism:Homo sapiens (Human)
Description:O96017
Residue:543
Sequence:
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163283
NameBDBM50163283
Synonyms:2-(4-Phenoxy-phenyl)-1H-benzoimidazole-4-carboxylic acid amide | CHEMBL176276
TypeSmall organic molecule
Emp. Form.C20H15N3O2
Mol. Mass.329.352
SMILESNC(=O)c1cccc2[nH]c(nc12)-c1ccc(Oc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a