Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50163391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302211
Kd 0.400000±n/a nM
Citation Surleraux, DLde Kock, HAVerschueren, WGPille, GMMaes, LJPeeters, AVendeville, SDe Meyer, SAzijn, HPauwels, Rde Bethune, MPKing, NMPrabu-Jeyabalan, MSchiffer, CAWigerinck, PB Design of HIV-1 protease inhibitors active on multidrug-resistant virus. J Med Chem48:1965-73 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163391
NameBDBM50163391
Synonyms:CHEMBL195725 | {3-[(4-Amino-benzenesulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-carbamic acid tetrahydro-furan-3-yl ester
TypeSmall organic molecule
Emp. Form.C25H35N3O6S
Mol. Mass.505.627
SMILESCC(C)CN(CC(O)C(Cc1ccccc1)NC(=O)OC1CCOC1)S(=O)(=O)c1ccc(N)cc1
Structure
n/a