Reaction Details |
 | Report a problem with these data |
Target | Human immunodeficiency virus type 1 protease |
---|
Ligand | BDBM50163391 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302211 |
---|
Kd | 0.400000±n/a nM |
---|
Citation | Surleraux, DL; de Kock, HA; Verschueren, WG; Pille, GM; Maes, LJ; Peeters, A; Vendeville, S; De Meyer, S; Azijn, H; Pauwels, R; de Bethune, MP; King, NM; Prabu-Jeyabalan, M; Schiffer, CA; Wigerinck, PB Design of HIV-1 protease inhibitors active on multidrug-resistant virus. J Med Chem48:1965-73 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Human immunodeficiency virus type 1 protease |
---|
Name: | Human immunodeficiency virus type 1 protease |
Synonyms: | Pol polyprotein |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | n/a |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50163391 |
---|
Name | BDBM50163391 |
Synonyms: | CHEMBL195725 | {3-[(4-Amino-benzenesulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-carbamic acid tetrahydro-furan-3-yl ester |
Type | Small organic molecule |
Emp. Form. | C25H35N3O6S |
Mol. Mass. | 505.627 |
SMILES | CC(C)CN(CC(O)C(Cc1ccccc1)NC(=O)OC1CCOC1)S(=O)(=O)c1ccc(N)cc1 |
Structure |  |
n/a |
---|