Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50166020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303360
Ki>50000±n/a nM
Citation Ding, KChen, JJi, MWu, XVarady, JYang, CYLu, YDeschamps, JRLevant, BWang, S Enantiomerically pure hexahydropyrazinoquinolines as potent and selective dopamine 3 subtype receptor ligands. J Med Chem48:3171-81 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:Dopamine receptor
Synonyms:D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.4
Type:Enzyme Catalytic Domain
Mol. Mass.:41307.65
Organism:RAT
Description:DOPAMINE D4.4 0 RAT::P30729
Residue:387
Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER
ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC
CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK
RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166020
NameBDBM50166020
Synonyms:CHEMBL190821 | Naphthalene-2-carboxylic acid {1-[2-((R)-8-methoxy-1,2,4,4a,5,6-hexahydro-pyrazino[1,2-a]quinolin-3-yl)-ethyl]-piperidin-4-yl}-amide
TypeSmall organic molecule
Emp. Form.C31H38N4O2
Mol. Mass.498.659
SMILESCOc1ccc2N3CCN(CCN4CCC(CC4)NC(=O)c4ccc5ccccc5c4)C[C@H]3CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a