Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50170765
Substrate/Competitorn/a
Meas. Tech.ChEMBL_317588
IC50 5.8±n/a nM
Citation Martín-Martínez, MMarty, AJourdan, MEscrieut, CArcher, EGonzález-Muñiz, RGarcía-López, MTMaigret, BHerranz, RFourmy, D Combination of molecular modeling, site-directed mutagenesis, and SAR studies to delineate the binding site of pyridopyrimidine antagonists on the human CCK1 receptor. J Med Chem48:4842-50 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:CCK-A receptor | CCK-AR | CCK1-R | Cholecystokinin receptor type A | Cholecystokinin-1 Receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47859.34
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-1 receptors in HEK 293 cells.
Residue:428
Sequence:
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170765
NameBDBM50170765
Synonyms:CHEMBL363916 | [(S)-1-((4aS,5R)-2-Benzyl-1-mercapto-3-oxo-octahydro-pyrido[1,2-c]pyrimidin-5-ylcarbamoyl)-2-(1H-indol-3-yl)-ethyl]-carbamic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C31H39N5O4S
Mol. Mass.577.737
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]1CCCN2C(S)N(Cc3ccccc3)C(=O)C[C@@H]12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a