Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor beta (LXRB)
LigandBDBM50167694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321112
EC50 10±n/a nM
Citation Liu, WChen, SDropinski, JColwell, LRobins, MSzymonifka, MHayes, NSharma, NMacNaul, KHernandez, MBurton, CSparrow, CPMenke, JGSingh, SB Design, synthesis, and structure-activity relationship of podocarpic acid amides as liver X receptor agonists for potential treatment of atherosclerosis. Bioorg Med Chem Lett15:4574-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor beta (LXRB)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50167694
NameBDBM50167694
Synonyms:2,6-dimethyl-13-methylcarbonyloxy-(2S)-tricyclo[8.4.0.02,7]tetradeca-1(10),11,13-triene-6-carboxylic 2,6-dimethyl-13-methylcarbonyloxy-(2S,6S,7R)-tricyclo[8.4.0.02,7]tetradeca-1(14),10,12-triene-6-carboxylic anhydride | 2,6-dimethyl-13-methylcarbonyloxy-(2S,6S,7R)-tricyclo[8.4.0.02,7]tetradeca-1(10),11,13-triene-6-carboxylic 2,6-dimethyl-13-methylcarbonyloxy-(2S,7R)-tricyclo[8.4.0.02,7]tetradeca-1(10),11,13-triene-6-carboxylic anhydride | CHEMBL191965
TypeSmall organic molecule
Emp. Form.C38H46O7
Mol. Mass.614.7676
SMILESCC(=O)Oc1ccc2CC[C@H]3C(C)(CCC[C@]3(C)c2c1)C(=O)OC(=O)[C@@]1(C)CCC[C@@]2(C)[C@H]1CCc1ccc(OC(C)=O)cc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a