Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 3
LigandBDBM50173935
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321550
IC50 1000±n/a nM
Citation Greenfield, AGrosanu, CDunlop, JMcIlvain, BCarrick, TJow, BLu, QKowal, DWilliams, JButera, J Synthesis and biological activities of aryl-ether-, biaryl-, and fluorene-aspartic acid and diaminopropionic acid analogs as potent inhibitors of the high-affinity glutamate transporter EAAT-2. Bioorg Med Chem Lett15:4985-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 3
Name:Excitatory amino acid transporter 3
Synonyms:Excitatory Amino Acid EAAT3
Type:Enzyme Catalytic Domain
Mol. Mass.:57096.71
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT3 0 HUMAN::P43005
Residue:524
Sequence:
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173935
NameBDBM50173935
Synonyms:2-Amino-N-biphenyl-4-yl-succinamic acid | CHEMBL198315
TypeSmall organic molecule
Emp. Form.C16H16N2O3
Mol. Mass.284.3098
SMILESNC(CC(=O)Nc1ccc(cc1)-c1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a