Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-amino-N-butyrate transaminase
LigandBDBM50177402
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332431
IC50 176000±n/a nM
Citation Tao, YHYuan, ZTang, XQXu, HBYang, XL Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. Bioorg Med Chem Lett16:592-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-amino-N-butyrate transaminase
Name:Gamma-amino-N-butyrate transaminase
Synonyms:(S)-3-amino-2-methylpropionate transaminase | 4-aminobutyrate aminotransferase, mitochondrial | GABA aminotransferase | GABA transaminase | GABA-AT | GABA-T | L-AIBAT
Type:PROTEIN
Mol. Mass.:56449.39
Organism:Homo sapiens (Human)
Description:ChEMBL_1459248
Residue:500
Sequence:
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177402
NameBDBM50177402
Synonyms:1-(4-hydroxy-phenyl)-propan-1-one | 1-(4-hydroxyphenyl)propan-1-one | 4'-Hydroxypropiophenone | CHEMBL312311 | Paroxypropione
TypeSmall organic molecule
Emp. Form.C9H10O2
Mol. Mass.150.1745
SMILESCCC(=O)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a