Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50092567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326510
IC50 1.7±n/a nM
Citation Martín-Martínez, MDe la Figuera, NLatorre, MGarcía-López, MTCenarruzabeitia, EDel Río, JGonzález-Muñiz, R Conformationally constrained CCK4 analogues incorporating IBTM and BTD beta-turn mimetics. J Med Chem48:7667-74 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin peripheral | Cholecystokinin receptor type A
Type:Enzyme Catalytic Domain
Mol. Mass.:49676.37
Organism:RAT
Description:Cholecystokinin central 0 RAT::P30551
Residue:444
Sequence:
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI
LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK
DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT
WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM
VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL
SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE
KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE
DGRTIRALLSRYSYSHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092567
NameBDBM50092567
Synonyms:(2R,5R,11bS,1'S)-2-[(2-Benzyloxycarbonylamino-3-oxo-2,3,5,6,11,11b-hexahydro-1H-indolizino[8,7-b]indole-5-carbonyl)-amino]-3-phenyl-propionic acid | (S)-2-((2R,5R,11bS)-2-(benzyloxycarbonyl)-3-oxo-2,3,5,6,11,11b-hexahydro-1H-indolizino[8,7-b]indole-5-carboxamido)-3-phenylpropanoic acid | (S)-2-[((5R,11bS)-2-Benzyloxycarbonylamino-3-oxo-2,3,5,6,11,11b-hexahydro-1H-indolizino[8,7-b]indole-5-carbonyl)-amino]-3-phenyl-propionic acid | CHEMBL13577
TypeSmall organic molecule
Emp. Form.C32H30N4O6
Mol. Mass.566.6038
SMILESOC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H]1Cc2c([nH]c3ccccc23)[C@@H]2C[C@@H](NC(=O)OCc3ccccc3)C(=O)N12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a