Target
Delta-type opioid receptor
Ligand
BDBM50178759
Substrate
n/a
Meas. Tech.
ChEMBL_326438
IC50
>10000±n/a nM
Citation
 Li, TFujita, YShiotani, KMiyazaki, ATsuda, YAmbo, ASasaki, YJinsmaa, YMarczak, EBryant, SDSalvadori, SLazarus, LHOkada, Y Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem 48:8035-44 (2005) [PubMed]  Article
Target
Name:
Delta-type opioid receptor
Synonyms:
DOR-1 | K56 | MSL-2 | OPIATE Delta | OPRD1 | Opioid receptors; mu and delta
Type:
Enzyme Catalytic Domain
Mol. Mass.:
40577.25
Organism:
MOUSE
Description:
P32300
Residue:
372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTACTPSDGPGGGAAA
  
Inhibitor
Name:
BDBM50178759
Synonyms:
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | CHEMBL370399
Type:
Small organic molecule
Emp. Form.:
C52H68N6O6
Mol. Mass.:
873.1329
SMILES:
CN(C)[C@@H](Cc1c(C)cc(O)cc1C)C(=O)N1Cc2ccccc2CC1C(=O)NCCCCCCNC(=O)C1Cc2ccccc2CN1C(=O)[C@H](Cc1c(C)cc(O)cc1C)N(C)C
Structure:
Search PDB for entries with ligand similarity: