Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50178759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326441
IC50>10000±n/a nM
Citation Li, TFujita, YShiotani, KMiyazaki, ATsuda, YAmbo, ASasaki, YJinsmaa, YMarczak, EBryant, SDSalvadori, SLazarus, LHOkada, Y Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem48:8035-44 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50178759
NameBDBM50178759
Synonyms:1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | CHEMBL370399
TypeSmall organic molecule
Emp. Form.C52H68N6O6
Mol. Mass.873.1329
SMILESCN(C)[C@@H](Cc1c(C)cc(O)cc1C)C(=O)N1Cc2ccccc2CC1C(=O)NCCCCCCNC(=O)C1Cc2ccccc2CN1C(=O)[C@H](Cc1c(C)cc(O)cc1C)N(C)C
Structure
n/a