Target
Mu-type opioid receptor
Ligand
BDBM50178759
Substrate
n/a
Meas. Tech.
ChEMBL_326441
IC50
>10000±n/a nM
Citation
 Li, TFujita, YShiotani, KMiyazaki, ATsuda, YAmbo, ASasaki, YJinsmaa, YMarczak, EBryant, SDSalvadori, SLazarus, LHOkada, Y Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem 48:8035-44 (2005) [PubMed]  Article
Target
Name:
Mu-type opioid receptor
Synonyms:
M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:
Enzyme Catalytic Domain
Mol. Mass.:
11165.58
Organism:
GUINEA PIG
Description:
P97266
Residue:
98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
  
Inhibitor
Name:
BDBM50178759
Synonyms:
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | CHEMBL370399
Type:
Small organic molecule
Emp. Form.:
C52H68N6O6
Mol. Mass.:
873.1329
SMILES:
CN(C)[C@@H](Cc1c(C)cc(O)cc1C)C(=O)N1Cc2ccccc2CC1C(=O)NCCCCCCNC(=O)C1Cc2ccccc2CN1C(=O)[C@H](Cc1c(C)cc(O)cc1C)N(C)C
Structure:
Search PDB for entries with ligand similarity: