Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50179116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_349701
Ki 10±n/a nM
Citation Farmer, LJMarron, KSCanan Koch, SSHwang, CKKallel, EAZhi, LNadzan, AMRobertson, DWBennani, YL Aza-retinoids as novel retinoid X receptor-specific agonists. Bioorg Med Chem Lett16:2352-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoid X receptor gamma/retinoic acid receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 3 | Retinoic acid receptor RXR-gamma | Retinoid X receptor gamma
Type:PROTEIN
Mol. Mass.:50878.26
Organism:Homo sapiens (Human)
Description:ChEMBL_197216
Residue:463
Sequence:
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179116
NameBDBM50179116
Synonyms:(2E,4E)-6-((6-tert-butyl-1,1-dimethyl-2,3-dihydro-1H-inden-4-yl)(propyl)amino)-3-methylhexa-2,4-dienoic acid | CHEMBL208316
TypeSmall organic molecule
Emp. Form.C25H37NO2
Mol. Mass.383.5668
SMILESCCCN(C\C=C\C(\C)=C\C(O)=O)c1cc(cc2c1CCC2(C)C)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a