Reaction Details |
 | Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50179192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_325358 |
---|
IC50 | 450±n/a nM |
---|
Citation | Balboni, G; Guerrini, R; Salvadori, S; Negri, L; Giannini, E; Bryant, SD; Jinsmaa, Y; Lazarus, LH Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem48:8112-4 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50179192 |
---|
Name | BDBM50179192 |
Synonyms: | (S)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl)-N-((1-methyl-1H-benzo[d]imidazol-2-yl)methyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | CHEMBL422547 |
Type | Small organic molecule |
Emp. Form. | C30H33N5O3 |
Mol. Mass. | 511.6147 |
SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)NCc1nc2ccccc2n1C |
Structure |  |
n/a |
---|