Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha (PPAR alpha)
LigandBDBM50179830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_339277
EC50 1±n/a nM
Citation Desai, RCMetzger, ESantini, CMeinke, PTHeck, JVBerger, JPMacNaul, KLCai, TQWright, SDAgrawal, AMoller, DESahoo, SP Design and synthesis of potent and subtype-selective PPARalpha agonists. Bioorg Med Chem Lett16:1673-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Name:Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR alpha/gamma | PPAR-alpha | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:52222.08
Organism:Homo sapiens (Human)
Description:Q07869
Residue:468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179830
NameBDBM50179830
Synonyms:(S)-2-(4-(3-(2-chloro-4-cyclohexylphenoxy)propoxy)benzyl)-2-methylbutanoic acid | CHEMBL424685
TypeSmall organic molecule
Emp. Form.C27H35ClO4
Mol. Mass.459.017
SMILESCC[C@@](C)(Cc1ccc(OCCCOc2ccc(cc2Cl)C2CCCCC2)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a