Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50179872
Substrate/Competitorn/a
Meas. Tech.ChEMBL_340909
EC50 30±n/a nM
Citation Li, LLiu, JZhu, LCutler, SHasegawa, HShan, BMedina, JC Discovery and optimization of a novel series of liver X receptor-alpha agonists. Bioorg Med Chem Lett16:1638-42 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179872
NameBDBM50179872
Synonyms:CHEMBL206674 | biphenyl-3-sulfonic acid methyl-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-phenyl]-amide
TypeSmall organic molecule
Emp. Form.C22H17F6NO3S
Mol. Mass.489.431
SMILESCN(c1ccc(cc1)C(O)(C(F)(F)F)C(F)(F)F)S(=O)(=O)c1cccc(c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a