Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50183665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350835
EC50 4400±n/a nM
Citation del Olmo, EBarboza, BYbarra, MILópez-Pérez, JLCarrón, RSevilla, MABoselli, CSan Feliciano, A Vasorelaxant activity of phthalazinones and related compounds. Bioorg Med Chem Lett16:2786-90 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha-1A adrenergic receptor
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183665
n/a
NameBDBM50183665
Synonyms:4-(4-chlorobenzyl)-2-allylphthalazin-1(2H)-one | CHEMBL207277
TypeSmall organic molecule
Emp. Form.C18H15ClN2O
Mol. Mass.310.778
SMILESClc1ccc(Cc2nn(CC=C)c(=O)c3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: