Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50031467
Substrate/Competitorn/a
Meas. Tech.ChEMBL_354949
IC50 16300±n/a nM
Citation Cho, SJRoh, JSSun, WSKim, SHPark, KD N-Benzylbenzamides: a new class of potent tyrosinase inhibitors. Bioorg Med Chem Lett16:2682-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031467
NameBDBM50031467
Synonyms:5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE | 5-Hydroxy-2-hydroxymethyl-pyran-4-one | CHEMBL287556 | Kojic Acid | US9422261, Kojic acid | US9682910, kojic acid
TypeSmall organic molecule
Emp. Form.C6H6O4
Mol. Mass.142.1094
SMILESOCc1cc(=O)c(O)co1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a