Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50186270
Substrate/Competitorn/a
Meas. Tech.ChEMBL_370711
Ki 0.8±n/a nM
Citation Jesudason, CDBeavers, LSCramer, JWDill, JFinley, DRLindsley, CWStevens, FCGadski, RAOldham, SWPickard, RTSiedem, CSSindelar, DKSingh, AWatson, BMHipskind, PA Synthesis and SAR of novel histamine H3 receptor antagonists. Bioorg Med Chem Lett16:3415-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50186270
NameBDBM50186270
Synonyms:2-benzyl-7-(3-(piperidin-1-yl)propoxy)-2,3,4,5-tetrahydro-1H-benzo[c]azepine | CHEMBL208611
TypeSmall organic molecule
Emp. Form.C25H34N2O
Mol. Mass.378.5503
SMILESC(COc1ccc2CN(Cc3ccccc3)CCCc2c1)CN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a