Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycine transporter 1
LigandBDBM50187874
Substrate/Competitorn/a
Meas. Tech.ChEMBL_387071
IC50 400±n/a nM
Citation Smith, GMikkelsen, GEskildsen, JBundgaard, C The synthesis and SAR of 2-arylsulfanylphenyl-1-oxyalkylamino acids as GlyT-1 inhibitors. Bioorg Med Chem Lett16:3981-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycine transporter 1
Name:Glycine transporter 1
Synonyms:GlyT-1 | GlyT1 | Glycine Transporters (GlyT1c) | Sodium- and chloride-dependent glycine transporter 1 | Sodium- and chloride-dependent glycine transporter 1 (GlyT1) | Sodium- and chloride-dependent glycine transporter 1 (GlyT1c) | Sodium-and chloride-dependent glycine transporter 1 (GlyT-1c) | Solute carrier family 6 member 9
Type:Enzyme
Mol. Mass.:78270.54
Organism:Homo sapiens (Human)
Description:P48067
Residue:706
Sequence:
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187874
NameBDBM50187874
Synonyms:(S)-1-(2-(4-chloro-2-(3-fluorophenylthio)phenoxy)ethyl)pyrrolidine-2-carboxylic acid | CHEMBL377605
TypeSmall organic molecule
Emp. Form.C19H19ClFNO3S
Mol. Mass.395.875
SMILESOC(=O)[C@@H]1CCCN1CCOc1ccc(Cl)cc1Sc1cccc(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a