Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-dependent protein kinase (PKA)
LigandBDBM50188913
Substrate/Competitorn/a
Meas. Tech.ChEMBL_389603
IC50 0.100000±n/a nM
Citation Lin, XMurray, JMRico, ACWang, MXChu, DTZhou, YDel Rosario, MKaufman, SMa, SFang, ECrawford, KJefferson, AB Discovery of 2-pyrimidyl-5-amidothiophenes as potent inhibitors for AKT: synthesis and SAR studies. Bioorg Med Chem Lett16:4163-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-dependent protein kinase (PKA)
Name:cAMP-dependent protein kinase (PKA)
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 217489
Components:This complex has 3 components.
Component 1
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-beta | PKAC-beta | cAMP-dependent protein kinase beta-1 catalytic subunit | cAMP-dependent protein kinase catalytic subunit beta
Type:PROTEIN
Mol. Mass.:40631.25
Organism:Homo sapiens (Human)
Description:ChEMBL_586348
Residue:351
Sequence:
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-alpha | cAMP-dependent protein kinase catalytic (PKA) | cAMP-dependent protein kinase catalytic subunit alpha | cAMP-dependent protein kinase catalytic subunit alpha (PKA) | cAMP-dependent protein kinase catalytic subunit alpha (PKACA) | cAMP-dependent protein kinase catalytic subunit alpha (PKAc) | cAMP-dependent protein kinase catalytic subunit alpha isoform 1 | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Catalytic Subunit
Mol. Mass.:40598.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-gamma | PRKACG | cAMP-dependent protein kinase catalytic subunit gamma
Type:PROTEIN
Mol. Mass.:40442.03
Organism:Homo sapiens (Human)
Description:ChEMBL_104720
Residue:351
Sequence:
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50188913
NameBDBM50188913
Synonyms:CHEMBL213618 | N-((S)-1-amino-3-(2,4-dichlorophenyl)propan-2-yl)-5-(2-(methylamino)pyrimidin-4-yl)thiophene-2-carboxamide | N-[(1S)-2-AMINO-1-(2,4-DICHLOROBENZYL)ETHYL]-5-[2-(METHYLAMINO)PYRIMIDIN-4-YL]THIOPHENE-2-CARBOXAMIDE
TypeSmall organic molecule
Emp. Form.C19H19Cl2N5OS
Mol. Mass.436.358
SMILESCNc1nccc(n1)-c1ccc(s1)C(=O)N[C@H](CN)Cc1ccc(Cl)cc1Cl
Structure
n/a