Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin and coagulation factor X
LigandBDBM50189937
Substrate/Competitorn/a
Meas. Tech.ChEMBL_393413
Ki 99000±n/a nM
Citation Hu, HKolesnikov, ARiggs, JRWesson, KEStephens, RLeahy, EMShrader, WDSprengeler, PAGreen, MJSanford, ENguyen, MGjerstad, ECabuslay, RYoung, WB Potent 4-amino-5-azaindole factor VIIa inhibitors. Bioorg Med Chem Lett16:4567-70 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombin and coagulation factor X
Name:Thrombin and coagulation factor X
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | F2 | Prothrombin | Prothrombin precursor | Thrombin heavy chain | Thrombin light chain
Type:Protein
Mol. Mass.:70029.57
Organism:Homo sapiens (Human)
Description:P00734
Residue:622
Sequence:
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189937
NameBDBM50189937
Synonyms:(S)-N-[3'-(4-amino-1H-pyrrolo[3,2-c]pyridin-2-yl)-2'-hydroxy-biphenyl-3-ylmethyl]-2-hydroxy-3-phenyl-propionamide | CHEMBL212401
TypeSmall organic molecule
Emp. Form.C29H26N4O3
Mol. Mass.478.5417
SMILESNc1nccc2[nH]c(cc12)-c1cccc(-c2cccc(CNC(=O)[C@@H](O)Cc3ccccc3)c2)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a