Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA2
LigandBDBM50191948
Substrate/Competitorn/a
Meas. Tech.ChEMBL_393590
EC50 111±n/a nM
Citation Zarrinmayeh, HTromiczak, EZimmerman, DMRankl, NHo, KHDominguez, ECastaño, AEscribano, AFernandez, CJimenez, AHornback, WJNisenbaum, ES A novel class of positive allosteric modulators of AMPA receptors: design, synthesis, and structure-activity relationships of 3-biphenyl-4-yl-4-cyano-5-ethyl-1-methyl-1H-pyrrole-2-carboxylic acid, LY2059346. Bioorg Med Chem Lett16:5203-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA2
Name:Glutamate receptor AMPA 2/3
Synonyms:AMPA-selective glutamate receptor 2 | GluR-2 | GluR-B | GluR-K2 | Glutamate AMPA 2 | Glutamate receptor 2 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 2
Type:Enzyme Catalytic Domain
Mol. Mass.:98825.96
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 2 GRIA2 HUMAN::P42262
Residue:883
Sequence:
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191948
NameBDBM50191948
Synonyms:4-cyano-5-ethyl-3-(2'-fluoro-biphenyl-4-yl)-1-methyl-1H-pyrrole-2-carboxylic acid | CHEMBL215575
TypeSmall organic molecule
Emp. Form.C21H17FN2O2
Mol. Mass.348.3703
SMILESCCc1c(C#N)c(c(C(O)=O)n1C)-c1ccc(cc1)-c1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a