Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetWee1-like protein kinase
LigandBDBM50192349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_379935
IC50 97±n/a nM
Citation Palmer, BDThompson, AMBooth, RJDobrusin, EMKraker, AJLee, HHLunney, EAMitchell, LHOrtwine, DFSmaill, JBSwan, LMDenny, WA 4-Phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione inhibitors of the checkpoint kinase Wee1. Structure-activity relationships for chromophore modification and phenyl ring substitution. J Med Chem49:4896-911 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Wee1-like protein kinase
Name:Wee1-like protein kinase
Synonyms:Serine/threonine-protein kinase WEE1 | WEE1 | WEE1 homolog (S. pombe)
Type:PROTEIN
Mol. Mass.:71599.12
Organism:Homo sapiens (Human)
Description:ChEMBL_1445054
Residue:646
Sequence:
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192349
NameBDBM50192349
Synonyms:9-HYDROXY-4-PHENYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE | CHEMBL214253
TypeSmall organic molecule
Emp. Form.C20H12N2O3
Mol. Mass.328.3209
SMILESOc1ccc2[nH]c3cc(c4C(=O)NC(=O)c4c3c2c1)-c1ccccc1
Structure
n/a