Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 1 (IMPDH1)
LigandBDBM50192467
Substrate/Competitorn/a
Meas. Tech.ChEMBL_381625
Ki 20±n/a nM
Citation Rejman, DOlesiak, MChen, LPatterson, SEWilson, DJayaram, HNHedstrom, LPankiewicz, KW Novel methylenephosphophosphonate analogues of mycophenolic adenine dinucleotide. Inhibition of inosine monophosphate dehydrogenase. J Med Chem49:5018-22 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 1 (IMPDH1)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 1 | IMPD 1 | IMPDH-I | Inosine-5''-monophosphate dehydrogenase 1
Type:Enzyme
Mol. Mass.:55407.70
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH1 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192467
NameBDBM50192467
Synonyms:CHEMBL384114 | P1-[7-hydroxy-6-(ethyl-2-yl)-5-methoxy-4-methylphthalan-1-one]methylenephospho-P2-(adenosin-5'-yl)phosphonate
TypeSmall organic molecule
Emp. Form.C23H29N5O14P2
Mol. Mass.661.449
SMILESCOc1c(C)c2COC(=O)c2c(O)c1CCOP(O)(=O)OCP(O)(=O)OCC1OC([C@@H](O)[C@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a