Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50194205
Substrate/Competitorn/a
Meas. Tech.ChEMBL_393879
EC50>10000±n/a nM
Citation Watanabe, MKazuta, YHayashi, HYamada, SMatsuda, AShuto, S Stereochemical diversity-oriented conformational restriction strategy. Development of potent histamine H3 and/or H4 receptor antagonists with an imidazolylcyclopropane structure. J Med Chem49:5587-96 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194205
NameBDBM50194205
Synonyms:(1R,2S)-trans-2-[2-(4-chlorobenzylamino)ethyl]-1-(1H-imidazol-4-yl)cyclopropane | CHEMBL213886
TypeSmall organic molecule
Emp. Form.C15H18ClN3
Mol. Mass.275.777
SMILESClc1ccc(CNCC[C@@H]2C[C@H]2c2cnc[nH]2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a