Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM50196145
Substrate/Competitorn/a
Meas. Tech.ChEMBL_406590
Ki 7.7±n/a nM
Citation Höglund, IPSilver, SEngström, MTSalo, HTauber, AKyyrönen, HKSaarenketo, PHoffrén, AMKokko, KPohjanoksa, KSallinen, JSavola, JMWurster, SKallatsa, OA Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. J Med Chem49:6351-63 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50196145
NameBDBM50196145
Synonyms:(R)-[4-(3,4-dimethylpiperazin-1-yl)phenyl]-(2,3,7,8-tetramethylquinolin-4-yl)amine | CHEMBL217567
TypeSmall organic molecule
Emp. Form.C25H32N4
Mol. Mass.388.5484
SMILESC[C@@H]1CN(CCN1C)c1ccc(Nc2c(C)c(C)nc3c(C)c(C)ccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a