Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor 2
LigandBDBM50196451
Substrate/Competitorn/a
Meas. Tech.ChEMBL_431932
Ki 13±n/a nM
Citation Kaur, NMonga, VLu, XGershengorn, MCJain, R Modifications of the pyroglutamic acid and histidine residues in thyrotropin-releasing hormone (TRH) yield analogs with selectivity for TRH receptor type 2 over type 1. Bioorg Med Chem15:433-43 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor 2
Name:Thyrotropin-releasing hormone receptor 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39044.21
Organism:Rattus norvegicus
Description:ChEMBL_532304
Residue:352
Sequence:
MDGPSNVSLIHGDTTLGLPEYKVVSVFLVLLVCTLGIVGNAMVILVVLTSRDMHTPTNCY
LVSLALADLLVLLAAGLPNVSDSLVGHWIYGRAGCLGITYFQYLGINVSSFSILAFTVER
YIAICHPLRAQTVCTVARAKRIIAGIWGVTSLYCLLWFFLVDLNVRDNQRLECGYKVPRG
LYLPIYLLDFAVFFIGPLLVTLVLYGLIGRILFQSPLSQEAWQKERQPHGQSEAAPGNCS
RAKSSRKQATRMLAVVVLLFAVLWTPYRTLVLLNSFVAQPFLDPWVLLFCRTCVYTNSAV
NPVVYSLMSQKFRAAFLKLCWCRAAGPQRRAARVLTSNYSAAQETSEGTEKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50196451
NameBDBM50196451
Synonyms:(2S)-1-{(2S)-3-(1-methyl-1H-4-imidazolyl)-2-[(2S)-6-oxohexahydro-2-pyridinylcarboxamido]propanoyl}azolane-2-carboxamide | CHEMBL223972
TypeSmall organic molecule
Emp. Form.C18H26N6O4
Mol. Mass.390.4368
SMILESCn1cnc(C[C@H](NC(=O)[C@@H]2CCCC(=O)N2)C(=O)N2CCC[C@H]2C(N)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a