Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50168371
Substrate/Competitorn/a
Meas. Tech.ChEMBL_453186
IC50 6400±n/a nM
Citation Song, SLee, HJin, YHa, YMBae, SChung, HYSuh, H Syntheses of hydroxy substituted 2-phenyl-naphthalenes as inhibitors of tyrosinase. Bioorg Med Chem Lett17:461-4 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168371
NameBDBM50168371
Synonyms:6-(3-Hydroxy-phenyl)-naphthalen-2-ol | 6-(3-hydroxyphenyl)-2-naphthol | 6-(3-hydroxyphenyl)naphthalen-2-ol | CHEMBL195217
TypeSmall organic molecule
Emp. Form.C16H12O2
Mol. Mass.236.2653
SMILESOc1cccc(c1)-c1ccc2cc(O)ccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a