Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50197638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_432312
IC50 500000±n/a nM
Citation Meadows, DCSanchez, TNeamati, NNorth, TWGervay-Hague, J Ring substituent effects on biological activity of vinyl sulfones as inhibitors of HIV-1. Bioorg Med Chem15:1127-37 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50197638
NameBDBM50197638
Synonyms:CHEMBL225417 | bis(trans-b-6-bromo-3,4-dimethoxy-styrenesulfonyl)methane
TypeSmall organic molecule
Emp. Form.C21H22Br2O8S2
Mol. Mass.626.333
SMILESCOc1cc(Br)c(\C=C\S(=O)(=O)CS(=O)(=O)\C=C\c2cc(OC)c(OC)cc2Br)cc1OC
Structure
n/a