Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50201698
Substrate/Competitorn/a
Meas. Tech.ChEMBL_438178
IC50 473±n/a nM
Citation Epple, RUrbina, HDRusso, RLiu, HMason, DBursulaya, BTumanut, CLi, JHarris, JL Bicyclic carbamates as inhibitors of papain-like cathepsin proteases. Bioorg Med Chem Lett17:1254-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201698
NameBDBM50201698
Synonyms:CHEMBL230473 | rac-trans4-(2,3-dimethylphenoxy)-6-oxa-1-aza-bicyclo[3.2.1]octan-7-one
TypeSmall organic molecule
Emp. Form.C14H17NO3
Mol. Mass.247.2897
SMILESCc1cccc(O[C@H]2CCN3C[C@@H]2OC3=O)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a