Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50205280
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425907
Ki 0.55±n/a nM
Citation Chang, LCvon Frijtag Drabbe Künzel, JKMulder-Krieger, TWesterhout, JSpangenberg, TBrussee, JIjzerman, AP 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem50:828-34 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205280
NameBDBM50205280
Synonyms:2,6-diphenyl-8-isobutyl-1-deazapurine | CHEMBL221486 | LUF-5978
TypeSmall organic molecule
Emp. Form.C22H21N3
Mol. Mass.327.4222
SMILESCC(C)Cc1nc2c(cc(nc2[nH]1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a