Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50206651
Substrate/Competitorn/a
Meas. Tech.ChEMBL_438448
Ki 3300±n/a nM
Citation Lee, YSNyberg, JMoye, SAgnes, RSDavis, PMa, SWLai, JPorreca, FVardanyan, RHruby, VJ Understanding the structural requirements of 4-anilidopiperidine analogues for biological activities at mu and delta opioid receptors. Bioorg Med Chem Lett17:2161-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Delta-type opioid receptor
Synonyms:D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206651
NameBDBM50206651
Synonyms:(S)-N-(1-(2-amino-3-(naphthalen-2-yl)propanoyl)piperidin-4-yl)-N-phenylpropionamide | CHEMBL230943
TypeSmall organic molecule
Emp. Form.C27H31N3O2
Mol. Mass.429.5539
SMILESCCC(=O)N(C1CCN(CC1)C(=O)[C@@H](N)Cc1ccc2ccccc2c1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a