Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50208058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429186
Ki 31.5±n/a nM
Citation Peretto, IFossati, CGiardina, GAGiardini, AGuala, MLa Porta, EPetrillo, PRadaelli, SRadice, LRaveglia, LFSantoro, EScudellaro, RScarpitta, FCerri, AMenegon, SDondio, GMRizzi, AArmani, EAmari, GCivelli, MVilletti, GPatacchini, RBergamaschi, MBassani, FDelcanale, MImbimbo, BP Discovery of diaryl imidazolidin-2-one derivatives, a novel class of muscarinic M3 selective antagonists (Part 2). J Med Chem50:1693-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208058
NameBDBM50208058
Synonyms:1-methyl-3-(2-oxo-4,4-diphenyl-imidazolidin-1-yl)-1-(2-oxo-2-phenyl-ethyl)-pyrrolidinium | CHEMBL222636
TypeSmall organic molecule
Emp. Form.C28H30N3O2
Mol. Mass.440.5562
SMILESC[N+]1(CC(=O)c2ccccc2)CCC(C1)N1CC(NC1=O)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a