Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y14
LigandBDBM50209661
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434326
EC50 880±n/a nM
Citation Ko, HFricks, IIvanov, AAHarden, TKJacobson, KA Structure-activity relationship of uridine 5'-diphosphoglucose analogues as agonists of the human P2Y14 receptor. J Med Chem50:2030-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y14
Name:Purinergic receptor P2Y14
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38991.62
Organism:Homo sapiens (Human)
Description:ChEMBL_1502487
Residue:338
Sequence:
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209661
NameBDBM50209661
Synonyms:CHEMBL226713 | [({[(2R,3S,4R,5R)-5-(2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy]({[(2R,3S,4S,5R)-2,3,4-trihydroxy-5-(hydroxymethyl)oxolan-2-yl]methoxy})phosphinic acid
TypeSmall organic molecule
Emp. Form.C15H24N2O17P2
Mol. Mass.566.3018
SMILESOC[C@H]1O[C@](O)(COP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2ccc(=O)[nH]c2=O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a