Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y14
LigandBDBM50209667
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434326
EC50 420±n/a nM
Citation Ko, HFricks, IIvanov, AAHarden, TKJacobson, KA Structure-activity relationship of uridine 5'-diphosphoglucose analogues as agonists of the human P2Y14 receptor. J Med Chem50:2030-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y14
Name:Purinergic receptor P2Y14
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38991.62
Organism:Homo sapiens (Human)
Description:ChEMBL_1502487
Residue:338
Sequence:
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209667
NameBDBM50209667
Synonyms:CHEMBL387520 | diphosphoric acid 1-alpha-D-glucopyranosuronic acid 2-((2'-thio)uridin-5''-yl)ester
TypeSmall organic molecule
Emp. Form.C15H22N2O17P2S
Mol. Mass.596.351
SMILESO[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)O[C@H]2O[C@@H]([C@@H](O)[C@H](O)[C@H]2O)C(O)=O)O[C@H]([C@@H]1O)n1ccc(=O)[nH]c1=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a