Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50209734
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434361
IC50 330±n/a nM
Citation Biswas, KLi, AChen, JJD'Amico, DCFotsch, CHan, NHuman, JLiu, QNorman, MHRiahi, BYuan, CSuzuki, HMareska, DAZhan, JClarke, DEToro, AGroneberg, RDBurgess, LELester-Zeiner, DBiddlecome, GManning, BHArik, LDong, HHuang, MKamassah, ALoeloff, RSun, HHsieh, FYKumar, GNg, GYHungate, RWAskew, BCJohnson, E Potent nonpeptide antagonists of the bradykinin B1 receptor: structure-activity relationship studies with novel diaminochroman carboxamides. J Med Chem50:2200-12 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209734
NameBDBM50209734
Synonyms:(R)-N-((R)-7-((tert-butylamino)methyl)chroman-4-yl)-3-phenyl-3-(4-(trifluoromethyl)phenylsulfonamido)propanamide | CHEMBL389054
TypeSmall organic molecule
Emp. Form.C30H34F3N3O4S
Mol. Mass.589.669
SMILESCC(C)(C)NCc1ccc2[C@@H](CCOc2c1)NC(=O)C[C@@H](NS(=O)(=O)c1ccc(cc1)C(F)(F)F)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a