Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor 1 (GluA1)
LigandBDBM50002370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_435002
Ki 0.022±n/a nM
Citation Vogensen, SBFrydenvang, KGreenwood, JRPostorino, GNielsen, BPickering, DSEbert, BBølcho, UEgebjerg, JGajhede, MKastrup, JSJohansen, TNClausen, RPKrogsgaard-Larsen, P A tetrazolyl-substituted subtype-selective AMPA receptor agonist. J Med Chem50:2408-14 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor 1 (GluA1)
Name:Glutamate receptor AMPA 1/2
Synonyms:Glutamate receptor ionotropic, AMPA 1
Type:Protein
Mol. Mass.:101583.91
Organism:Rattus norvegicus (Rat)
Description:P19490
Residue:907
Sequence:
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002370
NameBDBM50002370
Synonyms:(R,S)-alpha-amino-3-hydroxy-5-methyl-4-isooxazole-propionic acid | (RS)-2-amino-3-(3-hydroxy-5-methylisoxazol-4-yl)-propionicacid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid(DL-AMPA) | 2-amino-3-(3-hydroxy-5-methyl-4-isoxazolyl)-propionic acid | 2-amino-3-(5-methyl-3-oxo-2,3-dihydroisoxazol-4-yl)propanoic acid | 2-ammonio-3-(3-hydroxy-5-methylisoxazol-4-yl)propanoate | AMPA | CHEMBL13378
TypeSmall organic molecule
Emp. Form.C7H10N2O4
Mol. Mass.186.1653
SMILESCc1o[nH]c(=O)c1CC(N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a