Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 2
LigandBDBM50212180
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455667
IC50 54000±n/a nM
Citation Lindsley, SRMoore, KPRajapakse, HASelnick, HGYoung, MBZhu, HMunshi, SKuo, LMcGaughey, GBColussi, DCrouthamel, MCLai, MTPietrak, BPrice, EASankaranarayanan, SSimon, AJSeabrook, GRHazuda, DJPudvah, NTHochman, JHGraham, SLVacca, JPNantermet, PG Design, synthesis, and SAR of macrocyclic tertiary carbinamine BACE-1 inhibitors. Bioorg Med Chem Lett17:4057-61 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 2
Name:Beta-secretase 2
Synonyms:ASP1 | Asp 1 | Aspartic-like protease 56 kDa | Aspartyl protease 1 | Beta secretase 2 | Beta-secretase 2 (BACE-2) | Beta-secretase 2 precursor | Beta-site APP-cleaving enzyme 2 | Down region aspartic protease | Memapsin-1 | Membrane-associated aspartic protease 1 | beta-Secretase (BACE-2)
Type:Protein
Mol. Mass.:56171.20
Organism:Homo sapiens (Human)
Description:Q9Y5Z0
Residue:518
Sequence:
MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212180
NameBDBM50212180
Synonyms:CHEMBL400530 | N-((5R,14R)-5-amino-5-methyl-4,16-dioxo-14-phenyl-3-oxa-15-aza-tricyclo[15.3.1.1*7,11*]docosa-1(21),7,9,11(22),17,19-hexaen-19-yl)-N-propyl-methanesulfonamide
TypeSmall organic molecule
Emp. Form.C31H37N3O5S
Mol. Mass.563.708
SMILESCCCN(c1cc2COC(=O)[C@](C)(N)Cc3cccc(CC[C@@H](NC(=O)c(c2)c1)c1ccccc1)c3)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a