Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid binding protein muscle
LigandBDBM50212881
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455934
Ki>1000±n/a nM
Citation Sulsky, RMagnin, DRHuang, YSimpkins, LTaunk, PPatel, MZhu, YStouch, TRBassolino-Klimas, DParker, RHarrity, TStoffel, RTaylor, DSLavoie, TBKish, KJacobson, BLSheriff, SAdam, LPEwing, WRRobl, JA Potent and selective biphenyl azole inhibitors of adipocyte fatty acid binding protein (aFABP). Bioorg Med Chem Lett17:3511-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid binding protein muscle
Name:Fatty acid binding protein muscle
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:14858.36
Organism:Homo sapiens (Human)
Description:ChEMBL_1463784
Residue:133
Sequence:
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212881
NameBDBM50212881
Synonyms:CHEMBL396698 | [2'-(1-methyl-4,5-diphenyl-1H-imidazol-2-yl)-biphenyl-3-yloxy]-acetic acid
TypeSmall organic molecule
Emp. Form.C30H24N2O3
Mol. Mass.460.5232
SMILESCn1c(nc(c1-c1ccccc1)-c1ccccc1)-c1ccccc1-c1cccc(OCC(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a