Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50213617
Substrate/Competitorn/a
Meas. Tech.ChEMBL_456157
Ki 9±n/a nM
Citation Kai, HMorioka, YMurashi, TMorita, KShinonome, SNakazato, HKawamoto, KHanasaki, KTakahashi, FMihara, SArai, TAbe, KOkabe, HBaba, TYoshikawa, TTakenaka, H 2-Arylimino-5,6-dihydro-4H-1,3-thiazines as a new class of cannabinoid receptor agonists. Part 1: discovery of CB2 receptor selective compounds. Bioorg Med Chem Lett17:4030-4 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213617
NameBDBM50213617
Synonyms:(Z)-methyl 2-(2-isopropylphenylimino)-5,5-dimethyl-1,3-thiazinane-3-carbodithioate | CHEMBL232730
TypeSmall organic molecule
Emp. Form.C17H24N2S3
Mol. Mass.352.581
SMILESCSC(=S)N1CC(C)(C)CS\C1=N/c1ccccc1C(C)C
Structure
n/a