Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 2
LigandBDBM50219573
Substrate/Competitorn/a
Meas. Tech.ChEMBL_445833
Ki 26±n/a nM
Citation Wilson, DPWan, ZKXu, WXKirincich, SJFollows, BCJoseph-McCarthy, DForeman, KMoretto, AWu, JZhu, MBinnun, EZhang, YLTam, MErbe, DVTobin, JXu, XLeung, LShilling, ATam, SYMansour, TSLee, J Structure-based optimization of protein tyrosine phosphatase 1B inhibitors: from the active site to the second phosphotyrosine binding site. J Med Chem50:4681-98 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 2
Name:Tyrosine-protein phosphatase non-receptor type 2
Synonyms:T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP)
Type:Protein
Mol. Mass.:48481.80
Organism:Homo sapiens (Human)
Description:P17706
Residue:415
Sequence:
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219573
NameBDBM50219573
Synonyms:4-BROMO-3-(CARBOXYMETHOXY)-5-{3-[(3,3,5,5-TETRAMETHYLCYCLOHEXYL)AMINO]PHENYL}THIOPHENE-2-CARBOXYLIC ACID | 4-bromo-3-(carboxymethoxy)-5-(3-(3,3,5,5-tetramethylcyclohexylamino)phenyl)thiophene-2-carboxylic acid | 4-bromo-3-carboxymethoxy-5-[3-(3,3,5,5-tetramethylcyclohexylamino)phenyl]thiophene-2-carboxylic acid | CHEMBL243942
TypeSmall organic molecule
Emp. Form.C23H28BrNO5S
Mol. Mass.510.441
SMILESCC1(C)CC(CC(C)(C)C1)Nc1cccc(c1)-c1sc(C(O)=O)c(OCC(O)=O)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a