Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50219654
Substrate/Competitorn/a
Meas. Tech.ChEMBL_457234
EC50 22±n/a nM
Citation Reiter, LASubramanyam, CMangual, EJJones, CSSmeets, MIBrissette, WHMcCurdy, SPLira, PDLinde, RGLi, QZhang, FAntipas, ASBlumberg, LCDoty, JLDriscoll, JPMunchhof, MJRipp, SLShavnya, AShepard, RMSperger, DThomasco, LMTrevena, KAWolf-Gouveia, LAZhang, L Pyrimidine benzamide-based thrombopoietin receptor agonists. Bioorg Med Chem Lett17:5447-54 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219654
NameBDBM50219654
Synonyms:CHEMBL440231 | N-(4-(2-fluoro-3-(trifluoromethyl)phenyl)thiazol-2-yl)-4-(6-((2-hydroxyethyl)(methyl)amino)pyrimidin-4-ylamino)benzamide
TypeSmall organic molecule
Emp. Form.C24H20F4N6O2S
Mol. Mass.532.513
SMILESCN(CCO)c1cc(Nc2ccc(cc2)C(=O)Nc2nc(cs2)-c2cccc(c2F)C(F)(F)F)ncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a