Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 6
LigandBDBM50223308
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458154
Ki 4489±n/a nM
Citation Tasler, SKraus, JWuzik, AMüller, OAschenbrenner, ACubero, EPascual, RQuintana-Ruiz, JRDordal, AMercè, RCodony, X Discovery of 5-HT6 receptor ligands based on virtual HTS. Bioorg Med Chem Lett17:6224-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 6
Name:5-hydroxytryptamine receptor 6
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 (5-HT-6) | 5-hydroxytryptamine receptor 6 (5-HT6R) | 5-hydroxytryptamine receptor 6 (5HT6) | Serotonin (5-HT3) receptor | Serotonin 6 (5-HT6) receptor | Serotonin Receptor 6
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46968.43
Organism:Homo sapiens (Human)
Description:P50406
Residue:440
Sequence:
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50223308
NameBDBM50223308
Synonyms:CHEMBL398481 | N-benzhydryl-5-(4-methylpiperazin-1-yl)-2-nitrobenzenamine
TypeSmall organic molecule
Emp. Form.C24H26N4O2
Mol. Mass.402.4888
SMILESCN1CCN(CC1)c1ccc(c(NC(c2ccccc2)c2ccccc2)c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a