Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50224191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450592
EC50 0.74±n/a nM
Citation Altenbach, RJLiu, HBanfor, PNBrowman, KEFox, GBFryer, RMKomater, VAKrueger, KMMarsh, KMiller, TRPan, JBPan, LSun, MThiffault, CWetter, JZhao, CZhou, DEsbenshade, TAHancock, AACowart, MD Synthesis, potency, and in vivo profiles of quinoline containing histamine H3 receptor inverse agonists. J Med Chem50:5439-48 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224191
NameBDBM50224191
Synonyms:(R)-2-(1-(6-ethoxypyridazin-3-yl)-5-methyl-1H-pyrazol-4-yl)-6-(2-(2-methylpyrrolidin-1-yl)ethyl)quinoline | 2-[1-(6-ethoxypyridazin-3-yl)-5-methyl-1H-pyrazol-4-yl]-6-[2-(2-(R)-methylpyrrolidin-1-yl)ethyl]quinoline | CHEMBL237394
TypeSmall organic molecule
Emp. Form.C26H30N6O
Mol. Mass.442.556
SMILESCCOc1ccc(nn1)-n1ncc(c1C)-c1ccc2cc(CCN3CCC[C@H]3C)ccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a