Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM15249
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450842
IC50 6±n/a nM
Citation Li, GTao, ZFTong, YPrzytulinska, MKKovar, PMerta, PChen, ZZhang, HSowin, TRosenberg, SHLin, NH Synthesis and in-vitro biological activity of macrocyclic urea Chk1 inhibitors. Bioorg Med Chem Lett17:6499-504 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15249
NameBDBM15249
Synonyms:7-chloro-3-oxo-11,16-dioxa-2,4,19,21-tetraazatricyclo[15.3.1.0^{5,10}]henicosa-1(20),5(10),6,8,17(21),18-hexaene-18-carbonitrile | CHEMBL375097 | macrocyclic inhibitor 5c
TypeSmall organic molecule
Emp. Form.C16H14ClN5O3
Mol. Mass.359.767
SMILESClc1ccc2OCCCCOc3nc(NC(=O)Nc2c1)cnc3C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a