Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM50224734
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450879
IC50 227±n/a nM
Citation Bavetsias, VSun, CBouloc, NReynisson, JWorkman, PLinardopoulos, SMcDonald, E Hit generation and exploration: imidazo[4,5-b]pyridine derivatives as inhibitors of Aurora kinases. Bioorg Med Chem Lett17:6567-71 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224734
NameBDBM50224734
Synonyms:2-(4-(6-Chloro-2-(4-(dimethylamino)phenyl)-3H-imidazo[4,5-b]-pyridin-7-yl)piperazin-1-yl)-N-(thiazol-2-yl)acetamide | 2-(4-(6-chloro-2-(4-(dimethylamino)phenyl)-3H-imidazo[4,5-b]pyridin-7-yl)piperazin-1-yl)-N-(thiazol-2-yl)acetamide | CHEMBL392525
TypeSmall organic molecule
Emp. Form.C23H25ClN8OS
Mol. Mass.497.016
SMILESCN(C)c1ccc(cc1)-c1nc2ncc(Cl)c(N3CCN(CC(=O)Nc4nccs4)CC3)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a