Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor beta (LXRB)
LigandBDBM50227146
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461472
IC50 2±n/a nM
Citation Hu, BQuinet, EUnwalla, RCollini, MJetter, JDooley, RAndraka, DNogle, LSavio, DHalpern, AGoos-Nilsson, AWilhelmsson, ANambi, PWrobel, J Carboxylic acid based quinolines as liver X receptor modulators that have LXRbeta receptor binding selectivity. Bioorg Med Chem Lett18:54-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor beta (LXRB)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227146
NameBDBM50227146
Synonyms:2-(4-(3-(3-benzyl-8-(trifluoromethyl)quinolin-4-yl)benzylamino)-2,5-dimethylphenyl)acetic acid | CHEMBL403418
TypeSmall organic molecule
Emp. Form.C34H29F3N2O2
Mol. Mass.554.6015
SMILESCc1cc(NCc2cccc(c2)-c2c(Cc3ccccc3)cnc3c(cccc23)C(F)(F)F)c(C)cc1CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a