Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptors; A1 & A2a
LigandBDBM21175
Substrate/Competitorn/a
Meas. Tech.ChEMBL_460899
Ki 2±n/a nM
Citation Slee, DHZhang, XMoorjani, MLin, ELanier, MCChen, YRueter, JKLechner, SMMarkison, SMalany, SJoswig, TSantos, MGross, RSWilliams, JPCastro-Palomino, JCCrespo, MIPrat, MGual, SDíaz, JLWen, JO'Brien, ZSaunders, J Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem51:400-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptors; A1 & A2a
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21175
NameBDBM21175
Synonyms:CHEMBL252171 | N-[6-(3,5-dimethyl-1H-pyrazol-1-yl)-2-(furan-2-yl)pyrimidin-4-yl]-2-(4-methylpiperazin-1-yl)acetamide | Pyrimidine analogue, 27
TypeSmall organic molecule
Emp. Form.C20H25N7O2
Mol. Mass.395.4582
SMILESCN1CCN(CC(=O)Nc2cc(nc(n2)-c2ccco2)-n2nc(C)cc2C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a