Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-L-fucosidase 1
LigandBDBM50259958
Substrate/Competitorn/a
Meas. Tech.ChEMBL_545878
IC50 840000±n/a nM
Citation Yamashita, TYasuda, KKizu, HKameda, YWatson, AANash, RJFleet, GWAsano, N New polyhydroxylated pyrrolidine, piperidine, and pyrrolizidine alkaloids from Scilla sibirica. J Nat Prod65:1875-81 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-L-fucosidase 1
Name:Alpha-L-fucosidase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54093.12
Organism:Bos taurus
Description:ChEMBL_335897
Residue:468
Sequence:
MRSWVVGARLLLLLQLVLVLGAVRLPPCTDPRHCTDPPRYTPDWPSLDSRPLPAWFDEAK
FGVFVHWGVFSVPAWGSEWFWWHWQGEKLPQYESFMKENYPPDFSYADFGPRFTARFFNP
DSWADLFKAAGAKYVVLTTKHHEGYTNWPSPVSWNWNSKDVGPHRDLVGELGTAIRKRNI
RYGLYHSLLEWFHPLYLRDKKNGFKTQYFVNAKTMPELYDLVNRYKPDLIWSDGEWECPD
TYWNSTDFLAWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCKDKFQPETLPDHKWEMCT
SIDQRSWGYRRDMEMADITNESTIISELVQTVSLGGNYLLNVGPTKDGLIVPIFQERLLA
VGKWLSINGEAIYASKPWRVQSEKNSVWYTSKGLAVYAILLHWPEYGILSLISPIATSTT
KVTMLGIQKDLKWSLNPSGKGLLVFLPQLPPAALPTEFAWTIKLTGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259958
NameBDBM50259958
Synonyms:(2R,3S,4S,5S)-2-(2-hydroxyethyl)-5-(hydroxymethyl)pyrrolidine-3,4-diol | 2,5-imino-2,5,6-trideoxy-D-gulo-heptitol | CHEMBL464569
TypeSmall organic molecule
Emp. Form.C7H15NO4
Mol. Mass.177.1983
SMILESOCC[C@H]1N[C@@H](CO)[C@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a