Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetβ-galactosidase
LigandBDBM50242067
Substrate/Competitorn/a
Meas. Tech.ChEMBL_550271
IC50 90±n/a nM
Citation Asano, NIkeda, KKasahara, MArai, YKizu, H Glycosidase-inhibiting pyrrolidines and pyrrolizidines with a long side chain in Scilla peruviana. J Nat Prod67:846-50 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
β-galactosidase
Name:Beta-galactosidase/Glucosylceramidase
Synonyms:n/a
Type:Protein
Mol. Mass.:73420.88
Organism:Bos taurus (Bovine)
Description:n/a
Residue:653
Sequence:
MPGVVRLLALLLVPLLLGSARGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVP
RFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILR
PGPYICAEWDMGGLPAWLLEKKSIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPII
TVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGALQGLYATVD
FSPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDMLALGA
NVNMYMFIGGTNFAYWNGANIPYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFAKVP
EGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTM
LPEDCSDPTPLSSPLSGVHDRAYVSVNGVAQGILERESVITLNITGKAGATLDLLVENMG
RVNYGSSINDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAH
SPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTL
FVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVFRTVQTHRHAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242067
NameBDBM50242067
Synonyms:CHEMBL469435 | alpha-1-C-(1,10,13-Trihydroxytridecyl)-1,4-dideoxy-1,4-imino-D-arabinitol
TypeSmall organic molecule
Emp. Form.C18H37NO8
Mol. Mass.395.4883
SMILESOCC(O)CCCCC(O)CC(O)CCC[C@@H](O)[C@H]1N[C@H](CO)[C@@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a